SCOPe 2.07: Domain d3l73j_: 3l73 J:

Lineage for d3l73j_ (3l73 J:)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold

4. Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)
   automatically mapped to Pfam PF05365

5. Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)

6. Protein automated matches [190326] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [189231] (8 PDB entries)

8. Domain d3l73j_: 3l73 J: [247399]
   Other proteins in same PDB: d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73t_, d3l73u_
   automated match to d3l75j_
   complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq

Details for d3l73j_

PDB Entry: 3l73, 3.04 Å

PDB Description: cytochrome bc1 complex from chicken with triazolone inhibitor

PDB Compounds: (J:) Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein

SCOPe Domain Sequences for d3l73j_:

Sequence; same for both SEQRES and ATOM records:

>d3l73j_ f.23.14.1 (J:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyease
e

Timeline for d3l73j_:

• d3l73j_ first appeared in SCOPe 2.04
  
• d3l73j_ appears in SCOPe 2.06
  
• d3l73j_ appears in the current release, SCOPe 2.08