Lineage for d3l73f_ (3l73 F:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2632997Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
    membrane-associated alpha-helical protein; no transmembrane helices
  4. 2632998Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family) (S)
    location - matrix side of the bc1 complex
    automatically mapped to Pfam PF02271
  5. 2632999Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
    probably important for the complex assembly, caps the matrix face of cytochrome b
  6. 2633029Protein automated matches [190325] (4 species)
    not a true protein
  7. 2633042Species Chicken (Gallus gallus) [TaxId:9031] [189228] (8 PDB entries)
  8. 2633053Domain d3l73f_: 3l73 F: [247396]
    Other proteins in same PDB: d3l73a1, d3l73a2, d3l73b1, d3l73b2, d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73g_, d3l73h_, d3l73j_, d3l73n1, d3l73n2, d3l73o1, d3l73o2, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73t_, d3l73u_, d3l73w_
    automated match to d1l0lf_
    complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq

Details for d3l73f_

PDB Entry: 3l73 (more details), 3.04 Å

PDB Description: cytochrome bc1 complex from chicken with triazolone inhibitor
PDB Compounds: (F:) Mitochondrial ubiquinol-cytochrome c reductase 14 kda protein

SCOPe Domain Sequences for d3l73f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l73f_ f.27.1.1 (F:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls
lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk

SCOPe Domain Coordinates for d3l73f_:

Click to download the PDB-style file with coordinates for d3l73f_.
(The format of our PDB-style files is described here.)

Timeline for d3l73f_: