SCOPe 2.08: Domain d3l73b1: 3l73 B:20-235

Lineage for d3l73b1 (3l73 B:20-235)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
   core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta

4. Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families)
   Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues

5. Family d.185.1.0: automated matches [232765] (1 protein)
   not a true family

6. Protein automated matches [232766] (2 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries)

8. Domain d3l73b1: 3l73 B:20-235 [247390]
   Other proteins in same PDB: d3l73c1, d3l73c2, d3l73d1, d3l73d2, d3l73e1, d3l73e2, d3l73f_, d3l73g_, d3l73h_, d3l73j_, d3l73p1, d3l73p2, d3l73q1, d3l73q2, d3l73r1, d3l73r2, d3l73s_, d3l73t_, d3l73u_, d3l73w_
   automated match to d3l71o1
   complexed with bog, cdl, fes, gol, hec, hem, jzz, pee, uq

Details for d3l73b1

PDB Entry: 3l73, 3.04 Å

PDB Description: cytochrome bc1 complex from chicken with triazolone inhibitor

PDB Compounds: (B:) Mitochondrial ubiquinol-cytochrome-c reductase complex core protein 2

SCOPe Domain Sequences for d3l73b1:

Sequence; same for both SEQRES and ATOM records:

>d3l73b1 d.185.1.0 (B:20-235) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gaedleitklpngliiaslenfspasrigvfikagsryettanlgtahllrlasplttkg
assfritrgieavggslsvystrekmtycveclrdhvdtvmeyllnvttapefrpwevtd
lqpqlkvdkavafqspqvgvlenlhaaayktalanplycpdyrigkitseqlhhfvqnnf
tsarmalvgigvkhsdlkqvaeqflnirsgagtssa

Timeline for d3l73b1:

• d3l73b1 first appeared in SCOPe 2.04
  
• d3l73b1 appears in SCOPe 2.07