Class f: Membrane and cell surface proteins and peptides [56835] (60 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold |
Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family) automatically mapped to Pfam PF05365 |
Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins) |
Protein automated matches [190326] (4 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [189231] (8 PDB entries) |
Domain d3l72w_: 3l72 W: [247387] Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e1, d3l72e2, d3l72f_, d3l72g_, d3l72h_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72q2, d3l72r1, d3l72r2, d3l72s_, d3l72t_, d3l72u_ automated match to d3l75j_ complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq |
PDB Entry: 3l72 (more details), 3.06 Å
SCOPe Domain Sequences for d3l72w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l72w_ f.23.14.1 (W:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyease
Timeline for d3l72w_:
View in 3D Domains from other chains: (mouse over for more information) d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e1, d3l72e2, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72q2, d3l72r1, d3l72r2, d3l72s_, d3l72t_, d3l72u_ |