![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (40 superfamilies) not a true fold |
![]() | Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) ![]() |
![]() | Family f.23.11.0: automated matches [232790] (1 protein) not a true family |
![]() | Protein automated matches [232791] (3 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [232792] (8 PDB entries) |
![]() | Domain d3l72q2: 3l72 Q:196-241 [247383] Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72e1, d3l72e2, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72r1, d3l72r2, d3l72s_, d3l72t_, d3l72u_, d3l72w_ automated match to d3l70d2 complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq |
PDB Entry: 3l72 (more details), 3.06 Å
SCOPe Domain Sequences for d3l72q2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l72q2 f.23.11.0 (Q:196-241) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk
Timeline for d3l72q2:
![]() Domains from other chains: (mouse over for more information) d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e1, d3l72e2, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72r1, d3l72r2, d3l72s_, d3l72t_, d3l72u_, d3l72w_ |