SCOPe 2.08: Domain d3l72q2: 3l72 Q:196-241

Lineage for d3l72q2 (3l72 Q:196-241)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families)

5. Family f.23.11.0: automated matches [232790] (1 protein)
   not a true family

6. Protein automated matches [232791] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [232792] (8 PDB entries)

8. Domain d3l72q2: 3l72 Q:196-241 [247383]
   Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72e1, d3l72e2, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72r1, d3l72r2, d3l72s_, d3l72t_, d3l72u_, d3l72w_
   automated match to d3l70d2
   complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq

Details for d3l72q2

PDB Entry: 3l72, 3.06 Å

PDB Description: chicken cytochrome bc1 complex with kresoxim-i-dimethyl bound

PDB Compounds: (Q:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3l72q2:

Sequence; same for both SEQRES and ATOM records:

>d3l72q2 f.23.11.0 (Q:196-241) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk

Timeline for d3l72q2:

• d3l72q2 first appeared in SCOPe 2.04
  
• d3l72q2 appears in SCOPe 2.07