Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
Family d.185.1.0: automated matches [232765] (1 protein) not a true family |
Protein automated matches [232766] (2 species) not a true protein |
Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries) |
Domain d3l72n1: 3l72 N:3-233 [247376] Other proteins in same PDB: d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e1, d3l72e2, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72p1, d3l72p2, d3l72q1, d3l72q2, d3l72r1, d3l72r2, d3l72s_, d3l72t_, d3l72u_, d3l72w_ automated match to d3l71a1 complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq |
PDB Entry: 3l72 (more details), 3.06 Å
SCOPe Domain Sequences for d3l72n1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l72n1 d.185.1.0 (N:3-233) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} tyaqtlqnipetnvttldnglrvaseessqptctvgvwigagsryeneknngagyfvehl afkgtkkrpcaafekevesmgahfngytsreqtafyikalskdmpkvvelladvvqncal eesqiekergvilqelkemdndmtnvtfdylhatafqgtalartvegttenikhltradl asyidthfkaprmvlaaaggishkelvdaarqhfsgvsftykedavpilpr
Timeline for d3l72n1:
View in 3D Domains from other chains: (mouse over for more information) d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e1, d3l72e2, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72q2, d3l72r1, d3l72r2, d3l72s_, d3l72t_, d3l72u_, d3l72w_ |