SCOPe 2.08: Domain d3l72j_: 3l72 J:

Lineage for d3l72j_ (3l72 J:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.14: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81514] (1 family)
   automatically mapped to Pfam PF05365

5. Family f.23.14.1: Subunit X (non-heme 7 kDa protein) of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81513] (2 proteins)

6. Protein automated matches [190326] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [189231] (8 PDB entries)

8. Domain d3l72j_: 3l72 J: [247375]
   Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e1, d3l72e2, d3l72f_, d3l72g_, d3l72h_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72q2, d3l72r1, d3l72r2, d3l72s_, d3l72t_, d3l72u_
   automated match to d3l75j_
   complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq

Details for d3l72j_

PDB Entry: 3l72, 3.06 Å

PDB Description: chicken cytochrome bc1 complex with kresoxim-i-dimethyl bound

PDB Compounds: (J:) Mitochondrial ubiquinol-cytochrome c reductase 7.2 kda protein

SCOPe Domain Sequences for d3l72j_:

Sequence; same for both SEQRES and ATOM records:

>d3l72j_ f.23.14.1 (J:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
allrqaysalfrrtstfaltvvlgavlferafdqgadaifehlnegklwkhikhkyease
e

Timeline for d3l72j_:

• d3l72j_ first appeared in SCOPe 2.04
  
• d3l72j_ appears in SCOPe 2.07