SCOPe 2.08: Domain d3l72f_: 3l72 F:

Lineage for d3l72f_ (3l72 F:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.27: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81525] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.27.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81524] (1 family)
   location - matrix side of the bc1 complex
   automatically mapped to Pfam PF02271

5. Family f.27.1.1: 14 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81523] (2 proteins)
   probably important for the complex assembly, caps the matrix face of cytochrome b

6. Protein automated matches [190325] (4 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [189228] (8 PDB entries)

8. Domain d3l72f_: 3l72 F: [247372]
   Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72d2, d3l72e1, d3l72e2, d3l72g_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72q2, d3l72r1, d3l72r2, d3l72t_, d3l72u_, d3l72w_
   automated match to d1l0lf_
   complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq

Details for d3l72f_

PDB Entry: 3l72, 3.06 Å

PDB Description: chicken cytochrome bc1 complex with kresoxim-i-dimethyl bound

PDB Compounds: (F:) Mitochondrial ubiquinol-cytochrome c reductase 14 kda protein

SCOPe Domain Sequences for d3l72f_:

Sequence; same for both SEQRES and ATOM records:

>d3l72f_ f.27.1.1 (F:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
grlmdrirkwyynaagfnkyglmrddtlyedddvkealkrlpedlynermfrikraldls
lkhrilpkeqwvkyeedkpylepylkevirerlereawnkk

Timeline for d3l72f_:

• d3l72f_ first appeared in SCOPe 2.04
  
• d3l72f_ appears in SCOPe 2.07