Lineage for d3l72d2 (3l72 D:196-241)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025791Superfamily f.23.11: Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor [81496] (2 families) (S)
  5. 3025836Family f.23.11.0: automated matches [232790] (1 protein)
    not a true family
  6. 3025837Protein automated matches [232791] (3 species)
    not a true protein
  7. 3025842Species Chicken (Gallus gallus) [TaxId:9031] [232792] (8 PDB entries)
  8. 3025853Domain d3l72d2: 3l72 D:196-241 [247371]
    Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d1, d3l72e1, d3l72e2, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q1, d3l72r1, d3l72r2, d3l72s_, d3l72t_, d3l72u_, d3l72w_
    automated match to d3l70d2
    complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq

Details for d3l72d2

PDB Entry: 3l72 (more details), 3.06 Å

PDB Description: chicken cytochrome bc1 complex with kresoxim-i-dimethyl bound
PDB Compounds: (D:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3l72d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l72d2 f.23.11.0 (D:196-241) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
pehdqrkrmglkmllisalltsllyymkrhkwsvlksrkmayrppk

SCOPe Domain Coordinates for d3l72d2:

Click to download the PDB-style file with coordinates for d3l72d2.
(The format of our PDB-style files is described here.)

Timeline for d3l72d2: