SCOPe 2.08: Domain d3l72d1: 3l72 D:1-195

Lineage for d3l72d1 (3l72 D:1-195)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.3: Cytochrome bc1 domain [46676] (2 proteins)

6. Protein automated matches [232767] (3 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [232780] (8 PDB entries)

8. Domain d3l72d1: 3l72 D:1-195 [247370]
   Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72c2, d3l72d2, d3l72e1, d3l72e2, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72p2, d3l72q2, d3l72r1, d3l72r2, d3l72s_, d3l72t_, d3l72u_, d3l72w_
   automated match to d3l71d1
   complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq

Details for d3l72d1

PDB Entry: 3l72, 3.06 Å

PDB Description: chicken cytochrome bc1 complex with kresoxim-i-dimethyl bound

PDB Compounds: (D:) Mitochondrial cytochrome c1, heme protein

SCOPe Domain Sequences for d3l72d1:

Sequence; same for both SEQRES and ATOM records:

>d3l72d1 a.3.1.3 (D:1-195) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
gelelhppafpwshggplsaldhssvrrgfqvykqvcsachsmdyvafrnligvthteae
akalaeevevqdgpdengelfmrpgkisdyfpkpypnpeaaraanngalppdlsyivnar
hggedyvfslltgycdppagvvvreglhynpyfpgqaigmappiyneileyddgtpatms
qiakdvctflrwaae

Timeline for d3l72d1:

• d3l72d1 first appeared in SCOPe 2.04
  
• d3l72d1 appears in SCOPe 2.07