Lineage for d3l72c2 (3l72 C:262-380)

  1. Root: SCOPe 2.04
  2. 1695624Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)
  3. 1699388Fold f.32: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81649] (1 superfamily)
    core: three transmembrane helices, up-and-down bundle
  4. 1699389Superfamily f.32.1: a domain/subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81648] (2 families) (S)
  5. 1699453Family f.32.1.0: automated matches [254197] (1 protein)
    not a true family
  6. 1699454Protein automated matches [254431] (4 species)
    not a true protein
  7. 1699455Species Chicken (Gallus gallus) [TaxId:9031] [255857] (4 PDB entries)
  8. 1699462Domain d3l72c2: 3l72 C:262-380 [247369]
    Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c1, d3l72d1, d3l72d2, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p1, d3l72q1, d3l72q2, d3l72s_, d3l72t_, d3l72u_, d3l72w_
    automated match to d3l75c2
    complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq

Details for d3l72c2

PDB Entry: 3l72 (more details), 3.06 Å

PDB Description: chicken cytochrome bc1 complex with kresoxim-i-dimethyl bound
PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3l72c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l72c2 f.32.1.0 (C:262-380) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
plvtpphikpewyflfayailrsipnklggvlalaasvlilflipflhkskqrtmtfrpl
sqtlfwllvanlliltwigsqpvehpfiiigqmaslsyftillilfptigtlenkmlny

SCOPe Domain Coordinates for d3l72c2:

Click to download the PDB-style file with coordinates for d3l72c2.
(The format of our PDB-style files is described here.)

Timeline for d3l72c2: