SCOPe 2.08: Domain d3l72c1: 3l72 C:1-261

Lineage for d3l72c1 (3l72 C:1-261)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.21: Heme-binding four-helical bundle [81344] (3 superfamilies)
   core: four transmembrane helices, up-and-down bundle, binds one or two heme groups in between the helices

4. Superfamily f.21.1: Transmembrane di-heme cytochromes [81342] (2 families)
   Three of the four heme-ligands are conserved between the two families; both heme groups bind similarly but not identically

5. Family f.21.1.2: Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81642] (3 proteins)
   a part (domain) of a larger mitochondrial cytochrome b subunit, separate subunit in plants and cyanobacteria

6. Protein automated matches [196844] (6 species)
   not a true protein

7. Species Chicken (Gallus gallus) [TaxId:9031] [255856] (4 PDB entries)

8. Domain d3l72c1: 3l72 C:1-261 [247368]
   Other proteins in same PDB: d3l72a1, d3l72a2, d3l72b1, d3l72b2, d3l72c2, d3l72d1, d3l72d2, d3l72e1, d3l72e2, d3l72f_, d3l72g_, d3l72h_, d3l72j_, d3l72n1, d3l72n2, d3l72o1, d3l72o2, d3l72p2, d3l72q1, d3l72q2, d3l72r1, d3l72r2, d3l72s_, d3l72t_, d3l72u_, d3l72w_
   automated match to d3l75p1
   complexed with bog, cdl, fes, gol, hec, hem, ikr, pee, uq

Details for d3l72c1

PDB Entry: 3l72, 3.06 Å

PDB Description: chicken cytochrome bc1 complex with kresoxim-i-dimethyl bound

PDB Compounds: (C:) cytochrome b

SCOPe Domain Sequences for d3l72c1:

Sequence; same for both SEQRES and ATOM records:

>d3l72c1 f.21.1.2 (C:1-261) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
mapnirkshpllkminnslidlpapsnisawwnfgsllavclmtqiltglllamhytadt
slafssvahtcrnvqygwlirnlhangasffficiflhigrglyygsylyketwntgvil
lltlmatafvgyvlpwgqmsfwgatvitnlfsaipyightlvewawggfsvdnptltrff
alhfllpfaiagitiihltflhesgsnnplgissdsdkipfhpyysfkdilgltlmltpf
ltlalfspnllgdpenftpan

Timeline for d3l72c1:

• d3l72c1 first appeared in SCOPe 2.04
  
• d3l72c1 appears in SCOPe 2.07