SCOPe 2.08: Domain d3l5qy_: 3l5q Y:

Lineage for d3l5qy_ (3l5q Y:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome alpha subunit (non-catalytic) [56255] (10 species)
   contains an extension to the common fold at the N-terminus

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56257] (240 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3l5qy_: 3l5q Y: [247357]
   Other proteins in same PDB: d3l5q2_, d3l5qa_, d3l5qb1, d3l5qb2, d3l5qc_, d3l5qd1, d3l5qd2, d3l5qg_, d3l5qh_, d3l5qi_, d3l5qp_, d3l5qs_, d3l5qt_, d3l5qu_

Details for d3l5qy_

PDB Entry: 3l5q, 3 Å

PDB Description: Proteasome Activator Complex

PDB Compounds: (Y:) Proteasome component PUP1

SCOPe Domain Sequences for d3l5qy_:

Sequence; same for both SEQRES and ATOM records:

>d3l5qy_ d.153.1.4 (Y:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ttivgvkfnngvviaadtrstqgpivadkncaklhrispkiwcagagtaadteavtqlig
snielhslytsreprvvsalqmlkqhlfkyqghigaylivagvdptgshlfsihahgstd
vgyylslgsgslaamavleshwkqdltkeeaiklasdaiqagiwndlgsgsnvdvcvmei
gkdaeylrnyltpnvreekqksykfprgttavlkesivnicd

Timeline for d3l5qy_:

• d3l5qy_ first appeared in SCOPe 2.04
  
• d3l5qy_ appears in SCOPe 2.07