SCOPe 2.04: Domain d3l5q2_: 3l5q 2:

Lineage for d3l5q2_ (3l5q 2:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein Proteasome beta subunit (catalytic) [56252] (5 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [56254] (62 PDB entries)
   The structure of yeast proteasome complexed with the proteasome activator pa26 is available from PDB (1fnt). The 1FNT entry designates protein chains by both upper case and lower case letters creating problems with its processing and presentation in SCOP; the proteasome activator pa26 structure is classified elsewhere in SCOP (a.24.8)

8. Domain d3l5q2_: 3l5q 2: [247336]
   Other proteins in same PDB: d3l5q1_, d3l5q3_, d3l5q4_, d3l5qa_, d3l5qb_, d3l5qc_, d3l5qd_, d3l5qh_, d3l5qi_, d3l5qk_, d3l5ql_, d3l5qm_, d3l5qn_, d3l5qo_, d3l5qq_, d3l5qr_, d3l5qt_, d3l5qu_, d3l5qw_, d3l5qx_, d3l5qy_, d3l5qz_
   automated match to d1rypl_

Details for d3l5q2_

PDB Entry: 3l5q, 3 Å

PDB Description: Proteasome Activator Complex

PDB Compounds: (2:) Proteasome component PRE2

SCOPe Domain Sequences for d3l5q2_:

Sequence; same for both SEQRES and ATOM records:

>d3l5q2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tttlafrfqggiivavdsratagnwvasqtvkrvieinpfllgtmaggaadcqfwetwlg
sqcrlhelrekerisvaaaskilsnlvyqykgaglsmgtmicgytrkegptiyyvdsdgt
rlkgdifcvgsgqtfaygvldsnykwdlsvedalylgkrsilaaahrdaysggsvnlyhv
tedgwiyhgnhdvgelfwkvkeeegsfnnvig

Timeline for d3l5q2_:

• d3l5q2_ is new in SCOPe 2.04-stable
  
• d3l5q2_ appears in SCOPe 2.05
  
• d3l5q2_ appears in the current release, SCOPe 2.08