SCOPe 2.08: Domain d3l5ka1: 3l5k A:1-228

Lineage for d3l5ka1 (3l5k A:1-228)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.108: HAD-like [56783] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456

4. Superfamily c.108.1: HAD-like [56784] (26 families)
   usually contains an insertion (sub)domain after strand 1

5. Family c.108.1.0: automated matches [191369] (1 protein)
   not a true family

6. Protein automated matches [190447] (55 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188990] (19 PDB entries)

8. Domain d3l5ka1: 3l5k A:1-228 [247334]
   Other proteins in same PDB: d3l5ka2
   automated match to d3quba_
   complexed with cl, gol, k

Details for d3l5ka1

PDB Entry: 3l5k, 2 Å

PDB Description: the crystal structure of human haloacid dehalogenase-like hydrolase domain containing 1a (hdhd1a)

PDB Compounds: (A:) Haloacid dehalogenase-like hydrolase domain-containing protein 1A

SCOPe Domain Sequences for d3l5ka1:

Sequence; same for both SEQRES and ATOM records:

>d3l5ka1 c.108.1.0 (A:1-228) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maappqpvthlifdmdgllldterlysvvfqeicnrydkkyswdvkslvmgkkaleaaqi
iidvlqlpmskeelveesqtklkevfptaalmpgaekliihlrkhgipfalatssrsasf
dmktsrhkeffslfshivlgddpevqhgkpdpdiflacakrfspppamekclvfedapng
veaalaagmqvvmvpdgnlsrdlttkatlvlnslqdfqpelfglpsye

Timeline for d3l5ka1:

• d3l5ka1 first appeared in SCOPe 2.04, called d3l5ka_
  
• d3l5ka1 appears in SCOPe 2.07