Lineage for d3l3ba_ (3l3b A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2858750Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 2859252Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 2859253Protein automated matches [190197] (23 species)
    not a true protein
  7. 2859268Species Ehrlichia chaffeensis [TaxId:205920] [255917] (1 PDB entry)
  8. 2859269Domain d3l3ba_: 3l3b A: [247329]
    Other proteins in same PDB: d3l3bb2
    automated match to d1vhqb_

Details for d3l3ba_

PDB Entry: 3l3b (more details), 1.9 Å

PDB Description: crystal structure of isoprenoid biosynthesis protein with amidotransferase-like domain from ehrlichia chaffeensis at 1.90a resolution
PDB Compounds: (A:) Es1 family protein

SCOPe Domain Sequences for d3l3ba_:

Sequence, based on SEQRES records: (download)

>d3l3ba_ c.23.16.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
lnsavilagcghmdgseireavlvmleldrhnvnfkcfapnknqkqvvdhkkkesvgevr
nilvesariargsvydieqirveefdmlvipggygvaknfsnlfdedkendyilpefkna
vrefynakkpigavcispavvvallkdiakvkvtigedsnglidkmggvhvdcptiksvk
ddvnrifscsaymrndslynvylgiqdmissmvnyl

Sequence, based on observed residues (ATOM records): (download)

>d3l3ba_ c.23.16.0 (A:) automated matches {Ehrlichia chaffeensis [TaxId: 205920]}
lnsavilagcghmdgseireavlvmleldrhnvnfkcfapnknqkqvvdhkkkesvgevr
nilvesariargsvydieqirveefdmlvipggygvaknfsnlfdedndyilpefknavr
efynakkpigavcispavvvallkdiakvkvtigelidkmggvhvdcptiksvkddvnri
fscsaymrndslynvylgiqdmissmvnyl

SCOPe Domain Coordinates for d3l3ba_:

Click to download the PDB-style file with coordinates for d3l3ba_.
(The format of our PDB-style files is described here.)

Timeline for d3l3ba_: