Lineage for d3l08a3 (3l08 A:527-725)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2009600Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2009807Family a.118.1.6: Phoshoinositide 3-kinase (PI3K) helical domain [48399] (1 protein)
    automatically mapped to Pfam PF00613
    this is a repeat family; one repeat unit is 1e8y A:598-635 found in domain
  6. 2009808Protein Phoshoinositide 3-kinase (PI3K) helical domain [48400] (2 species)
  7. 2009809Species Human (Homo sapiens) [TaxId:9606] [48402] (65 PDB entries)
  8. 2009817Domain d3l08a3: 3l08 A:527-725 [247309]
    Other proteins in same PDB: d3l08a1, d3l08a2, d3l08a4
    automated match to d1e7ua1
    complexed with so4, zig

Details for d3l08a3

PDB Entry: 3l08 (more details), 2.7 Å

PDB Description: structure of pi3k gamma with a potent inhibitor: gsk2126458
PDB Compounds: (A:) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma isoform

SCOPe Domain Sequences for d3l08a3:

Sequence, based on SEQRES records: (download)

>d3l08a3 a.118.1.6 (A:527-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
ialpkhqptpdpegdrvraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhp
kaypklfssvkwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavq
klesledddvlhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqs
rhyqqrfavileaylrgcg

Sequence, based on observed residues (ATOM records): (download)

>d3l08a3 a.118.1.6 (A:527-725) Phoshoinositide 3-kinase (PI3K) helical domain {Human (Homo sapiens) [TaxId: 9606]}
ialpkhqraempnqlrkqleaiiatdplnpltaedkellwhfryeslkhpkaypklfssv
kwgqqeivaktyqllarrevwdqsaldvgltmqlldcnfsdenvraiavqklesledddv
lhyllqlvqavkfepyhdsalarfllkrglrnkrighflfwflrseiaqsrhyqqrfavi
leaylrgcg

SCOPe Domain Coordinates for d3l08a3:

Click to download the PDB-style file with coordinates for d3l08a3.
(The format of our PDB-style files is described here.)

Timeline for d3l08a3: