SCOPe 2.06: Domain d3kt5a1: 3kt5 A:1-99

Lineage for d3kt5a1 (3kt5 A:1-99)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.50: Acid proteases [50629] (1 superfamily)
   barrel, closed; n=6, S=10, complex topology

4. Superfamily b.50.1: Acid proteases [50630] (4 families)

5. Family b.50.1.1: Retroviral protease (retropepsin) [50631] (9 proteins)
   dimer of identical mono-domain chains, each containing (6,10) barrel

6. Protein Human immunodeficiency virus type 1 protease [50632] (9 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [50633] (476 PDB entries)
   Uniprot P35963 57-155 ! Uniprot P04587 69-167 ! Uniprot P03366 69-167 ! Uniprot P03367 69-167 ! Uniprot P03368 69-167

8. Domain d3kt5a1: 3kt5 A:1-99 [247276]
   automated match to d1g6la2
   mutant

Details for d3kt5a1

PDB Entry: 3kt5, 1.8 Å

PDB Description: crystal structure of n88s mutant hiv-1 protease

PDB Compounds: (A:) Protease

SCOPe Domain Sequences for d3kt5a1:

Sequence; same for both SEQRES and ATOM records:

>d3kt5a1 b.50.1.1 (A:1-99) Human immunodeficiency virus type 1 protease {Human immunodeficiency virus type 1 [TaxId: 11676]}
pqvtlwqrplvtikiggqlkealldtgaddtvleemslpgrwkpkmiggiggfikvrqyd
qilieicghkaigtvlvgptpvniigrslltqigatlnf

Timeline for d3kt5a1:

• d3kt5a1 first appeared in SCOPe 2.04
  
• d3kt5a1 appears in SCOPe 2.05
  
• d3kt5a1 appears in SCOPe 2.07
  
• d3kt5a1 appears in the current release, SCOPe 2.08