SCOPe 2.04: Domain d3krxg_: 3krx G:

Lineage for d3krxg_ (3krx G:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
   not a true fold

4. Superfamily a.137.3: Transducin (heterotrimeric G protein), gamma chain [48670] (1 family)
   long alpha-helix interrupted in the middle
   automatically mapped to Pfam PF00631

5. Family a.137.3.1: Transducin (heterotrimeric G protein), gamma chain [48671] (1 protein)

6. Protein Transducin (heterotrimeric G protein), gamma chain [48672] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [48673] (20 PDB entries)

8. Domain d3krxg_: 3krx G: [247259]
   Other proteins in same PDB: d3krxa1, d3krxa2, d3krxa3, d3krxb_
   automated match to d2trcg_
   complexed with ba1, mg

Details for d3krxg_

PDB Entry: 3krx, 3.1 Å

PDB Description: Human GRK2 in complex with Gbetgamma subunits and balanol (co-crystal)

PDB Compounds: (G:) Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2

SCOPe Domain Sequences for d3krxg_:

Sequence; same for both SEQRES and ATOM records:

>d3krxg_ a.137.3.1 (G:) Transducin (heterotrimeric G protein), gamma chain {Cow (Bos taurus) [TaxId: 9913]}
siaqarklveqlkmeanidrikvskaaadlmayceahakedplltpvpasenpfrekkff
c

Timeline for d3krxg_:

• d3krxg_ is new in SCOPe 2.04-stable
  
• d3krxg_ appears in SCOPe 2.05
  
• d3krxg_ appears in the current release, SCOPe 2.08