Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (195 species) not a true protein |
Species Chromobacterium violaceum [TaxId:536] [255907] (1 PDB entry) |
Domain d3kebd_: 3keb D: [247149] automated match to d2yzhd_ complexed with cl, so4 |
PDB Entry: 3keb (more details), 1.8 Å
SCOPe Domain Sequences for d3kebd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3kebd_ c.47.1.0 (D:) automated matches {Chromobacterium violaceum [TaxId: 536]} edfwvqygdemlpvigdfprkgdylpsfmlvddqkhdaalesfshtpklivtllsvdede hagllllretrrfldswphlklivitvdspsslararhehglpniallstlrgrdfhkry gvliteyplsgytspaiiladaanvvhyserlantrdffdfdaiekllqegeqqa
Timeline for d3kebd_: