Lineage for d3kaab_ (3kaa B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2761199Domain d3kaab_: 3kaa B: [247128]
    automated match to d3bi9x_
    complexed with ca, psf

Details for d3kaab_

PDB Entry: 3kaa (more details), 3 Å

PDB Description: Structure of Tim-3 in complex with phosphatidylserine
PDB Compounds: (B:) Hepatitis A virus cellular receptor 2

SCOPe Domain Sequences for d3kaab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3kaab_ b.1.1.0 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dgykvevgknaylpcsytlptsgtlvpmcwgkgfcpwsqctnellrtdernvtyqkssry
qlkgdlnkgdvsliiknvtlddhgtyccriqfpglmndkklelkldika

SCOPe Domain Coordinates for d3kaab_:

Click to download the PDB-style file with coordinates for d3kaab_.
(The format of our PDB-style files is described here.)

Timeline for d3kaab_: