SCOPe 2.07: Domain d3kaaa_: 3kaa A:

Lineage for d3kaaa_ (3kaa A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (29 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)

8. Domain d3kaaa_: 3kaa A: [247127]
   automated match to d3bi9x_
   complexed with ca, psf

Details for d3kaaa_

PDB Entry: 3kaa, 3 Å

PDB Description: Structure of Tim-3 in complex with phosphatidylserine

PDB Compounds: (A:) Hepatitis A virus cellular receptor 2

SCOPe Domain Sequences for d3kaaa_:

Sequence; same for both SEQRES and ATOM records:

>d3kaaa_ b.1.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gykvevgknaylpcsytlptsgtlvpmcwgkgfcpwsqctnellrtdernvtyqkssryq
lkgdlnkgdvsliiknvtlddhgtyccriqfpglmndkklelkldik

Timeline for d3kaaa_:

• d3kaaa_ first appeared in SCOPe 2.04
  
• d3kaaa_ appears in SCOPe 2.06
  
• d3kaaa_ appears in the current release, SCOPe 2.08