Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (14 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries) |
Domain d3k23c_: 3k23 C: [247097] automated match to d3vhva_ complexed with jzn |
PDB Entry: 3k23 (more details), 3 Å
SCOPe Domain Sequences for d3k23c_:
Sequence, based on SEQRES records: (download)
>d3k23c_ a.123.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lpqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgf rnlhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpgmydqck hmlyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkr egnssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipky sngnikkllfh
>d3k23c_ a.123.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lpqltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgf rnlhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpgmydqck hmlyvsselhrlqvsyeeylcmktllllssvpkdglkqelfdeirmtyikelgkaivkre gnssqnwqrfyqltklldsmhevvenllnycfqtfldktmiefpemlaeiitnqipkyni kkllfh
Timeline for d3k23c_: