Lineage for d3k23b_ (3k23 B:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1747085Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1747086Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1747087Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1747981Protein automated matches [190059] (14 species)
    not a true protein
  7. 1748003Species Human (Homo sapiens) [TaxId:9606] [187214] (138 PDB entries)
  8. 1748222Domain d3k23b_: 3k23 B: [247096]
    automated match to d3vhva_
    complexed with jzn

Details for d3k23b_

PDB Entry: 3k23 (more details), 3 Å

PDB Description: glucocorticoid receptor with bound d-prolinamide 11
PDB Compounds: (B:) Glucocorticoid receptor

SCOPe Domain Sequences for d3k23b_:

Sequence, based on SEQRES records: (download)

>d3k23b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrn
lhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpgmydqckhm
lyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkreg
nssqnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysn
gnikkllfhq

Sequence, based on observed residues (ATOM records): (download)

>d3k23b_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qltptlvslleviepevlyagydssvpdstwrimttlnmlggrqviaavkwakaipgfrn
lhlddqmtllqyswmylmafalgwrsyrqssanllcfapdliineqrmtlpgmydqckhm
lyvsselhrlqvsyeeylcmktllllssvpkdglksqelfdeirmtyikelgkaivkres
qnwqrfyqltklldsmhevvenllnycfqtfldktmsiefpemlaeiitnqipkysngni
kkllfhq

SCOPe Domain Coordinates for d3k23b_:

Click to download the PDB-style file with coordinates for d3k23b_.
(The format of our PDB-style files is described here.)

Timeline for d3k23b_: