Lineage for d3jw0d_ (3jw0 D:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224083Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
    consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation
  4. 2224084Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) (S)
    automatically mapped to Pfam PF00632
  5. 2224100Family d.148.1.0: automated matches [227207] (1 protein)
    not a true family
  6. 2224101Protein automated matches [226939] (2 species)
    not a true protein
  7. 2224102Species Human (Homo sapiens) [TaxId:9606] [225255] (16 PDB entries)
  8. 2224116Domain d3jw0d_: 3jw0 D: [247067]
    Other proteins in same PDB: d3jw0a_, d3jw0b_, d3jw0c2, d3jw0x_, d3jw0y_
    automated match to d4bbna_

Details for d3jw0d_

PDB Entry: 3jw0 (more details), 3.1 Å

PDB Description: E2~Ubiquitin-HECT
PDB Compounds: (D:) E3 ubiquitin-protein ligase NEDD4-like

SCOPe Domain Sequences for d3jw0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jw0d_ d.148.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
efkqkydyfrkklkkpadipnrfemklhrnnifeesyrrimsvkrpdvlkarlwiefese
kgldyggvarewffllskemfnpyyglfeysatdnytlqinpnsglcnedhlsyftfigr
vaglavfhgklldgffirpfykmmlgkqitlndmesvdseyynslkwilendpteldlmf
cideenfgqtyqvdlkpngseimvtnenkreyidlviqwrfvnrvqkqmnaflegftell
pidlikifdenelellmcglgdvdvndwrqhsiykngycpnhpviqwfwkavllmdaekr
irllqfvtgtsrvpmngfaelygsngpqlftieqwgspeklprahtsfnrldlppyetfe
dlrekllmavenaq

SCOPe Domain Coordinates for d3jw0d_:

Click to download the PDB-style file with coordinates for d3jw0d_.
(The format of our PDB-style files is described here.)

Timeline for d3jw0d_: