![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily) consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation |
![]() | Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) ![]() automatically mapped to Pfam PF00632 |
![]() | Family d.148.1.0: automated matches [227207] (1 protein) not a true family |
![]() | Protein automated matches [226939] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225255] (17 PDB entries) |
![]() | Domain d3jw0d_: 3jw0 D: [247067] Other proteins in same PDB: d3jw0a_, d3jw0b_, d3jw0c2, d3jw0x_, d3jw0y_ automated match to d4bbna_ |
PDB Entry: 3jw0 (more details), 3.1 Å
SCOPe Domain Sequences for d3jw0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jw0d_ d.148.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} efkqkydyfrkklkkpadipnrfemklhrnnifeesyrrimsvkrpdvlkarlwiefese kgldyggvarewffllskemfnpyyglfeysatdnytlqinpnsglcnedhlsyftfigr vaglavfhgklldgffirpfykmmlgkqitlndmesvdseyynslkwilendpteldlmf cideenfgqtyqvdlkpngseimvtnenkreyidlviqwrfvnrvqkqmnaflegftell pidlikifdenelellmcglgdvdvndwrqhsiykngycpnhpviqwfwkavllmdaekr irllqfvtgtsrvpmngfaelygsngpqlftieqwgspeklprahtsfnrldlppyetfe dlrekllmavenaq
Timeline for d3jw0d_: