Lineage for d3jw0c_ (3jw0 C:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1676023Fold d.148: Hect, E3 ligase catalytic domain [56203] (1 superfamily)
    consists of two alpha+beta domains; the N-terminal domain is array of helices and beta-hairpins; the C-terminal domain is an a/b sandwich with one left-handed beta-alpha(n)-beta unit; conformational flexibility of domain orientation
  4. 1676024Superfamily d.148.1: Hect, E3 ligase catalytic domain [56204] (2 families) (S)
    automatically mapped to Pfam PF00632
  5. 1676040Family d.148.1.0: automated matches [227207] (1 protein)
    not a true family
  6. 1676041Protein automated matches [226939] (1 species)
    not a true protein
  7. 1676042Species Human (Homo sapiens) [TaxId:9606] [225255] (8 PDB entries)
  8. 1676051Domain d3jw0c_: 3jw0 C: [247066]
    Other proteins in same PDB: d3jw0a_, d3jw0b_, d3jw0x_, d3jw0y_
    automated match to d4bbna_

Details for d3jw0c_

PDB Entry: 3jw0 (more details), 3.1 Å

PDB Description: E2~Ubiquitin-HECT
PDB Compounds: (C:) E3 ubiquitin-protein ligase NEDD4-like

SCOPe Domain Sequences for d3jw0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jw0c_ d.148.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fefkqkydyfrkklkkpadipnrfemklhrnnifeesyrrimsvkrpdvlkarlwiefes
ekgldyggvarewffllskemfnpyyglfeysatdnytlqinpnsglcnedhlsyftfig
rvaglavfhgklldgffirpfykmmlgkqitlndmesvdseyynslkwilendpteldlm
fcideenfgqtyqvdlkpngseimvtnenkreyidlviqwrfvnrvqkqmnaflegftel
lpidlikifdenelellmcglgdvdvndwrqhsiykngycpnhpviqwfwkavllmdaek
rirllqfvtgtsrvpmngfaelygsngpqlftieqwgspeklprahtsfnrldlppyetf
edlrekllmavenaqg

SCOPe Domain Coordinates for d3jw0c_:

Click to download the PDB-style file with coordinates for d3jw0c_.
(The format of our PDB-style files is described here.)

Timeline for d3jw0c_: