Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.20: UBC-like [54494] (1 superfamily) alpha-beta(4)-alpha(3); core: meander beta-sheet plus one helix 2 |
Superfamily d.20.1: UBC-like [54495] (5 families) |
Family d.20.1.1: UBC-related [54496] (7 proteins) |
Protein Ubiquitin conjugating enzyme, UBC [54497] (33 species) |
Species Human (Homo sapiens), ubch5b [TaxId:9606] [102841] (11 PDB entries) Uniprot P62837 E2-17 kDa 2 |
Domain d3jw0a_: 3jw0 A: [247064] Other proteins in same PDB: d3jw0c_, d3jw0d_, d3jw0x_, d3jw0y_ automated match to d3a33a_ |
PDB Entry: 3jw0 (more details), 3.1 Å
SCOPe Domain Sequences for d3jw0a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jw0a_ d.20.1.1 (A:) Ubiquitin conjugating enzyme, UBC {Human (Homo sapiens), ubch5b [TaxId: 9606]} askrihkelndlardppaqcsagpvgddmfhwqatimgpndspyqggvffltihfptdyp fkppkvafttriyhpninsngsisldilrsqwspalkiskvllsicsllcdpnpddplvp eiariyktdrekynriarewtqkyam
Timeline for d3jw0a_: