Lineage for d3jv4e_ (3jv4 E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765064Family b.1.18.1: NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain [81279] (8 proteins)
    subgroup of the larger IPT/TIG domain family
  6. 2765168Protein automated matches [226855] (1 species)
    not a true protein
  7. 2765169Species Mouse (Mus musculus) [TaxId:10090] [224977] (9 PDB entries)
  8. 2765184Domain d3jv4e_: 3jv4 E: [247057]
    Other proteins in same PDB: d3jv4b_, d3jv4d_, d3jv4f_
    automated match to d1zk9a_

Details for d3jv4e_

PDB Entry: 3jv4 (more details), 3.15 Å

PDB Description: Crystal structure of the dimerization domains p50 and RelB
PDB Compounds: (E:) transcription factor relb

SCOPe Domain Sequences for d3jv4e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3jv4e_ b.1.18.1 (E:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tselricrinkesgpctggeelyllcdkvqkedisvvfstaswegradfsqadvhrqiai
vfktppyedleisepvtvnvflqrltdgvcseplpftylpr

SCOPe Domain Coordinates for d3jv4e_:

Click to download the PDB-style file with coordinates for d3jv4e_.
(The format of our PDB-style files is described here.)

Timeline for d3jv4e_: