Class b: All beta proteins [48724] (180 folds) |
Fold b.113: N-terminal domain of MutM-like DNA repair proteins [81625] (1 superfamily) pseudobarrel; capped on both ends by alpha-helices |
Superfamily b.113.1: N-terminal domain of MutM-like DNA repair proteins [81624] (2 families) automatically mapped to Pfam PF01149 |
Family b.113.1.1: N-terminal domain of MutM-like DNA repair proteins [81623] (4 proteins) |
Protein automated matches [254692] (3 species) not a true protein |
Species Geobacillus stearothermophilus [TaxId:1422] [255898] (1 PDB entry) |
Domain d3jr5a1: 3jr5 A:2-134 [247023] Other proteins in same PDB: d3jr5a2, d3jr5a3 automated match to d1r2za2 protein/DNA complex; complexed with gol, zn |
PDB Entry: 3jr5 (more details), 1.7 Å
SCOPe Domain Sequences for d3jr5a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3jr5a1 b.113.1.1 (A:2-134) automated matches {Geobacillus stearothermophilus [TaxId: 1422]} pqlpevetirrtllplivgktiedvrifwpniirhprdseafaarmigqtvrglerrgkf lkflldrdalishlrmegryavasaleplephthvvfcftdgselryrdvrkfgtmhvya keeadrrpplael
Timeline for d3jr5a1: