SCOPe 2.06: Domain d3ivkl1: 3ivk L:1-108

Lineage for d3ivkl1 (3ivk L:1-108)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)

8. Domain d3ivkl1: 3ivk L:1-108 [246974]
   Other proteins in same PDB: d3ivkb2, d3ivkl2
   automated match to d3pgfl1
   protein/RNA complex; complexed with cd, cl, mg

Details for d3ivkl1

PDB Entry: 3ivk, 3.1 Å

PDB Description: crystal structure of the catalytic core of an rna polymerase ribozyme complexed with an antigen binding antibody fragment

PDB Compounds: (L:) Fab light chain

SCOPe Domain Sequences for d3ivkl1:

Sequence; same for both SEQRES and ATOM records:

>d3ivkl1 b.1.1.0 (L:1-108) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
sdiqmtqspsslsasvgdrvtitcrasqsvssavawyqqkpgkapklliysasslysgvp
srfsgsrsgtdftltisslqpedfatyycqqsysfpstfgqgtkveik

Timeline for d3ivkl1:

• d3ivkl1 first appeared in SCOPe 2.04
  
• d3ivkl1 appears in SCOPe 2.05
  
• d3ivkl1 appears in SCOPe 2.07
  
• d3ivkl1 appears in the current release, SCOPe 2.08