SCOPe 2.04: Domain d3ivkb2: 3ivk B:109-213

Lineage for d3ivkb2 (3ivk B:109-213)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d3ivkb2: 3ivk B:109-213 [246973]
   Other proteins in same PDB: d3ivkb1, d3ivkl1
   automated match to d4jg1l2
   protein/RNA complex; complexed with cd, cl, mg

Details for d3ivkb2

PDB Entry: 3ivk, 3.1 Å

PDB Description: crystal structure of the catalytic core of an rna polymerase ribozyme complexed with an antigen binding antibody fragment

PDB Compounds: (B:) Fab light chain

SCOPe Domain Sequences for d3ivkb2:

Sequence; same for both SEQRES and ATOM records:

>d3ivkb2 b.1.1.2 (B:109-213) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglsspvtksfnrg

Timeline for d3ivkb2:

• d3ivkb2 is new in SCOPe 2.04-stable
  
• d3ivkb2 appears in SCOPe 2.05
  
• d3ivkb2 appears in the current release, SCOPe 2.08