Lineage for d3itbd1 (3itb D:2-258)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2568471Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 2568472Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 2569658Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. 2569659Protein automated matches [190857] (45 species)
    not a true protein
  7. 2569813Species Escherichia coli [TaxId:562] [225496] (15 PDB entries)
  8. 2569828Domain d3itbd1: 3itb D:2-258 [246964]
    Other proteins in same PDB: d3itba2, d3itbb2, d3itbc2, d3itbd2
    automated match to d3it9a1
    complexed with so4, suc

Details for d3itbd1

PDB Entry: 3itb (more details), 1.8 Å

PDB Description: crystal structure of penicillin-binding protein 6 (pbp6) from e. coli in complex with a substrate fragment
PDB Compounds: (D:) D-alanyl-D-alanine carboxypeptidase dacC

SCOPe Domain Sequences for d3itbd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3itbd1 e.3.1.0 (D:2-258) automated matches {Escherichia coli [TaxId: 562]}
aeqtveapsvdarawilmdyasgkvlaegnadekldpasltkimtsyvvgqalkadkikl
tdmvtvgkdawatgnpalrgssvmflkpgdqvsvadlnkgviiqsgndacialadyvags
qesfiglmngyakklgltnttfqtvhgldapgqfstardmallgkalihdvpeeyaihke
keftfnkirqpnrnrllwssnlnvdgmktgttagagynlvasatqgdmrlisvvlgaktd
rirfneseklltwgfrf

SCOPe Domain Coordinates for d3itbd1:

Click to download the PDB-style file with coordinates for d3itbd1.
(The format of our PDB-style files is described here.)

Timeline for d3itbd1: