Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.130: S-adenosylmethionine synthetase [55972] (1 superfamily) duplication: consists of 3 similar intertwined domains structural repeat: beta-alpha-beta(2)-alpha-beta; two layers, alpha/beta |
Superfamily d.130.1: S-adenosylmethionine synthetase [55973] (2 families) |
Family d.130.1.0: automated matches [254267] (1 protein) not a true family |
Protein automated matches [254617] (15 species) not a true protein |
Species Burkholderia pseudomallei [TaxId:28450] [255893] (1 PDB entry) |
Domain d3imld2: 3iml D:123-235 [246944] Other proteins in same PDB: d3imla4 automated match to d2p02a2 |
PDB Entry: 3iml (more details), 2.35 Å
SCOPe Domain Sequences for d3imld2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3imld2 d.130.1.0 (D:123-235) automated matches {Burkholderia pseudomallei [TaxId: 28450]} qglmfgyacdetpelmplpihlshrlverqanlrrdgrlpwlrpdaksqvtvryvdgkph sidtvvlstqhapeidlpalreavieevikptlpadlikgdikflvnptgrfv
Timeline for d3imld2: