SCOPe 2.08: Domain d3ilah_: 3ila H:

Lineage for d3ilah_ (3ila H:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.6: MIR domain [82109] (3 families)

5. Family b.42.6.2: Ryanodine receptor N-terminal-like [254181] (3 proteins)
   Pfam PF08709; members of this family have a helical insert between beta strands 4 and 5

6. Protein N-terminal domain of ryanodine receptor type 1 [254405] (1 species)

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [254841] (2 PDB entries)

8. Domain d3ilah_: 3ila H: [246929]
   automated match to d3hsma_

Details for d3ilah_

PDB Entry: 3ila, 2.9 Å

PDB Description: Crystal structure of rabbit ryanodine receptor 1 N-terminal domain (9-205)

PDB Compounds: (H:) Ryanodine receptor 1

SCOPe Domain Sequences for d3ilah_:

Sequence, based on SEQRES records:

>d3ilah_ b.42.6.2 (H:) N-terminal domain of ryanodine receptor type 1 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qflrtddevvlqcsatvlkeqlklclaaegfgnrlcfleptsnaqnvppdlaiccftleq
slsvralqemlantveagvessqggghrtllyghaillrhahsrmylsclttsrsmtdkl
afdvglqedatgeacwwtmhpaskqrsegekvrvgddlilvsvsserylhlstasgelqv
dasfmqtlwnmnp

Sequence, based on observed residues (ATOM records):

>d3ilah_ b.42.6.2 (H:) N-terminal domain of ryanodine receptor type 1 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
qflrtddevvlqcsatvleqlklclaaegfrlcfleptpdlaiccftleqslsvralqem
lahrtllyghaillrhahsrmylsclttslafdvglqedatgeacwwtmhpaskrsegek
vrvgddlilvsvsserylhlsgelqvdasfmqtlwnmnp

Timeline for d3ilah_:

• d3ilah_ first appeared in SCOPe 2.04
  
• d3ilah_ appears in SCOPe 2.07