Class b: All beta proteins [48724] (180 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.6: MIR domain [82109] (3 families) |
Family b.42.6.2: Ryanodine receptor N-terminal-like [254181] (3 proteins) Pfam PF08709; members of this family have a helical insert between beta strands 4 and 5 |
Protein N-terminal domain of ryanodine receptor type 1 [254405] (1 species) |
Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [254841] (2 PDB entries) |
Domain d3ilah_: 3ila H: [246929] automated match to d3hsma_ |
PDB Entry: 3ila (more details), 2.9 Å
SCOPe Domain Sequences for d3ilah_:
Sequence, based on SEQRES records: (download)
>d3ilah_ b.42.6.2 (H:) N-terminal domain of ryanodine receptor type 1 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} qflrtddevvlqcsatvlkeqlklclaaegfgnrlcfleptsnaqnvppdlaiccftleq slsvralqemlantveagvessqggghrtllyghaillrhahsrmylsclttsrsmtdkl afdvglqedatgeacwwtmhpaskqrsegekvrvgddlilvsvsserylhlstasgelqv dasfmqtlwnmnp
>d3ilah_ b.42.6.2 (H:) N-terminal domain of ryanodine receptor type 1 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} qflrtddevvlqcsatvleqlklclaaegfrlcfleptpdlaiccftleqslsvralqem lahrtllyghaillrhahsrmylsclttslafdvglqedatgeacwwtmhpaskrsegek vrvgddlilvsvsserylhlsgelqvdasfmqtlwnmnp
Timeline for d3ilah_: