Lineage for d3ii0d1 (3ii0 D:14-412)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2502820Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2502821Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2504326Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2504327Protein automated matches [190151] (160 species)
    not a true protein
  7. 2504859Species Human (Homo sapiens) [TaxId:9606] [188446] (29 PDB entries)
  8. 2504899Domain d3ii0d1: 3ii0 D:14-412 [246915]
    Other proteins in same PDB: d3ii0a2, d3ii0b2, d3ii0c2, d3ii0c3, d3ii0d2, d3ii0d3
    automated match to d4eu1a_
    complexed with edo, plp, tar

Details for d3ii0d1

PDB Entry: 3ii0 (more details), 2.05 Å

PDB Description: crystal structure of human glutamate oxaloacetate transaminase 1 (got1)
PDB Compounds: (D:) Aspartate aminotransferase, cytoplasmic

SCOPe Domain Sequences for d3ii0d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ii0d1 c.67.1.0 (D:14-412) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qpvlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkiandnslnheylp
ilglaefrscasrlalgddspalkekrvggvqslggtgalrigadflarwyngtnnkntp
vyvssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenapefsivvlhaca
hnptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawairyfvsegfeffc
aqsfsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaqgarivastlsn
pelfeewtgnvktmadriltmrselrarlealktpgtwnhitdqigmfsftglnpkqvey
lvnekhiyllpsgrinvsglttknldyvatsiheavtki

SCOPe Domain Coordinates for d3ii0d1:

Click to download the PDB-style file with coordinates for d3ii0d1.
(The format of our PDB-style files is described here.)

Timeline for d3ii0d1: