Lineage for d3ii0c_ (3ii0 C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1866060Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1866061Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1867290Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1867291Protein automated matches [190151] (98 species)
    not a true protein
  7. 1867591Species Human (Homo sapiens) [TaxId:9606] [188446] (19 PDB entries)
  8. 1867604Domain d3ii0c_: 3ii0 C: [246914]
    automated match to d4eu1a_
    complexed with edo, plp, tar

Details for d3ii0c_

PDB Entry: 3ii0 (more details), 2.05 Å

PDB Description: crystal structure of human glutamate oxaloacetate transaminase 1 (got1)
PDB Compounds: (C:) Aspartate aminotransferase, cytoplasmic

SCOPe Domain Sequences for d3ii0c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ii0c_ c.67.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mqpvlvfkltadfredpdprkvnlgvgayrtddchpwvlpvvkkveqkiandnslnheyl
pilglaefrscasrlalgddspalkekrvggvqslggtgalrigadflarwyngtnnknt
pvyvssptwenhnavfsaagfkdirsyrywdaekrgldlqgflndlenapefsivvlhac
ahnptgidptpeqwkqiasvmkhrflfpffdsayqgfasgnlerdawairyfvsegfeff
caqsfsknfglynervgnltvvgkepesilqvlsqmekivritwsnppaqgarivastls
npelfeewtgnvktmadriltmrselrarlealktpgtwnhitdqigmfsftglnpkqve
ylvnekhiyllpsgrinvsglttknldyvatsiheavtkiaenlyfq

SCOPe Domain Coordinates for d3ii0c_:

Click to download the PDB-style file with coordinates for d3ii0c_.
(The format of our PDB-style files is described here.)

Timeline for d3ii0c_: