SCOPe 2.08: Domain d3ibrb2: 3ibr B:118-309

Lineage for d3ibrb2 (3ibr B:118-309)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.2: GAF domain-like [55781] (5 families)
   alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654

5. Family d.110.2.0: automated matches [191507] (1 protein)
   not a true family

6. Protein automated matches [190838] (19 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [255839] (2 PDB entries)

8. Domain d3ibrb2: 3ibr B:118-309 [246899]
   Other proteins in same PDB: d3ibra1, d3ibrb1
   automated match to d3nhqa2
   complexed with bla; mutant

Details for d3ibrb2

PDB Entry: 3ibr, 2.97 Å

PDB Description: crystal structure of p. aeruginosa bacteriophytochrome photosensory core module mutant q188l in the mixed pr/pfr state

PDB Compounds: (B:) Bacteriophytochrome

SCOPe Domain Sequences for d3ibrb2:

Sequence; same for both SEQRES and ATOM records:

>d3ibrb2 d.110.2.0 (B:118-309) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
lsitsftlnaqriiaqvqlhndtasllsnvtdelrrmtgydrvmayrfrhddsgevvaes
rredlesylglrypasdipaqarrlyiqnpirliadvaytpmrvfpalnpetnesfdlsy
svlrsvspihceyltnmgvrasmsisivvggklwglfschhmspklipypvrmsfqifsq
vcsaiverleqg

Timeline for d3ibrb2:

• d3ibrb2 first appeared in SCOPe 2.04
  
• d3ibrb2 appears in SCOPe 2.07