SCOPe 2.08: Domain d3ibra1: 3ibr A:6-117

Lineage for d3ibra1 (3ibr A:6-117)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.110: Profilin-like [55769] (10 superfamilies)
   core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha

4. Superfamily d.110.3: PYP-like sensor domain (PAS domain) [55785] (8 families)
   alpha-beta(2)-alpha(2)-beta(3)

5. Family d.110.3.9: BphP N-terminal domain-like [160669] (3 proteins)
   Pfam PF08446; PAS_2

6. Protein Bacteriophytochrome BphP [160672] (3 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [160674] (7 PDB entries)
   Uniprot Q9HWR3 5-117

8. Domain d3ibra1: 3ibr A:6-117 [246895]
   Other proteins in same PDB: d3ibra2, d3ibra3, d3ibrb2, d3ibrb3
   automated match to d3nhqa1
   complexed with bla; mutant

Details for d3ibra1

PDB Entry: 3ibr, 2.97 Å

PDB Description: crystal structure of p. aeruginosa bacteriophytochrome photosensory core module mutant q188l in the mixed pr/pfr state

PDB Compounds: (A:) Bacteriophytochrome

SCOPe Domain Sequences for d3ibra1:

Sequence; same for both SEQRES and ATOM records:

>d3ibra1 d.110.3.9 (A:6-117) Bacteriophytochrome BphP {Pseudomonas aeruginosa [TaxId: 287]}
pvtlancedepihvpgaiqphgalvtlradgmvlaaseniqallgfvaspgsyltqeqvg
pevlrmleegltgngpwsnsvetrigehlfdvighsykevfylefeirtadt

Timeline for d3ibra1:

• d3ibra1 first appeared in SCOPe 2.04
  
• d3ibra1 appears in SCOPe 2.07