Class b: All beta proteins [48724] (176 folds) |
Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) |
Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins) |
Protein beta-Galactosidase [49804] (2 species) |
Species Escherichia coli [TaxId:562] [49805] (42 PDB entries) Uniprot P00722 |
Domain d3iaqd1: 3iaq D:13-219 [246838] Other proteins in same PDB: d3iaqa2, d3iaqa3, d3iaqa4, d3iaqa5, d3iaqb2, d3iaqb3, d3iaqb4, d3iaqb5, d3iaqc2, d3iaqc3, d3iaqc4, d3iaqc5, d3iaqd2, d3iaqd3, d3iaqd4, d3iaqd5 automated match to d1f49a3 complexed with btb, dms, mg, na |
PDB Entry: 3iaq (more details), 2.7 Å
SCOPe Domain Sequences for d3iaqd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3iaqd1 b.18.1.5 (D:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3iaqd1:
View in 3D Domains from same chain: (mouse over for more information) d3iaqd2, d3iaqd3, d3iaqd4, d3iaqd5 |