Lineage for d3iaqa1 (3iaq A:13-219)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776981Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 1776982Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 1777099Family b.18.1.5: beta-Galactosidase/glucuronidase, N-terminal domain [49803] (4 proteins)
  6. 1777100Protein beta-Galactosidase [49804] (2 species)
  7. 1777108Species Escherichia coli [TaxId:562] [49805] (42 PDB entries)
    Uniprot P00722
  8. 1777217Domain d3iaqa1: 3iaq A:13-219 [246823]
    Other proteins in same PDB: d3iaqa2, d3iaqa3, d3iaqa4, d3iaqa5, d3iaqb2, d3iaqb3, d3iaqb4, d3iaqb5, d3iaqc2, d3iaqc3, d3iaqc4, d3iaqc5, d3iaqd2, d3iaqd3, d3iaqd4, d3iaqd5
    automated match to d1f49a3
    complexed with btb, dms, mg, na

Details for d3iaqa1

PDB Entry: 3iaq (more details), 2.7 Å

PDB Description: e. coli (lacz) beta-galactosidase (e416v)
PDB Compounds: (A:) beta-galactosidase

SCOPe Domain Sequences for d3iaqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3iaqa1 b.18.1.5 (A:13-219) beta-Galactosidase {Escherichia coli [TaxId: 562]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3iaqa1:

Click to download the PDB-style file with coordinates for d3iaqa1.
(The format of our PDB-style files is described here.)

Timeline for d3iaqa1: