SCOPe 2.05: Domain d3iamf_: 3iam F:

Lineage for d3iamf_ (3iam F:)

1. Root: SCOPe 2.05

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.19: HydA/Nqo6-like [56769] (1 superfamily)
   2 domains: (1) alpa/beta; (2) Fe-S cluster-bound

4. Superfamily e.19.1: HydA/Nqo6-like [56770] (3 families)

5. Family e.19.1.2: Nq06-like [144031] (2 proteins)
   Pfam PF01058

6. Protein automated matches [254687] (1 species)
   not a true protein

7. Species Thermus thermophilus HB8 [TaxId:300852] [255885] (3 PDB entries)

8. Domain d3iamf_: 3iam F: [246800]
   Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam31, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc1, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamg_, d3iamh_
   automated match to d2fug61
   complexed with ca, fes, fmn, mg, nai, sf4

Details for d3iamf_

PDB Entry: 3iam, 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, reduced, 2 mol/ASU, with bound NADH

PDB Compounds: (F:) NADH-quinone oxidoreductase subunit 6

SCOPe Domain Sequences for d3iamf_:

Sequence, based on SEQRES records:

>d3iamf_ e.19.1.2 (F:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
eregilfttleklvawgrsnslwpatfglaccaiemmastdarndlarfgsevfrasprq
advmivagrlskkmapvmrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvd
vyvpgcpprpealiyavmqlqkkvrgqaynergerlppvaa

Sequence, based on observed residues (ATOM records):

>d3iamf_ e.19.1.2 (F:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
eregilfttleklvawgrsnslwpatfglaccaiemmastdaqadvmivagrlskkmapv
mrrvweqmpdpkwvismgacassggmfnnyaivqnvdsvvpvdvyvpgcpprpealiyav
mqlqkkvrgqaynergerlppvaa

Timeline for d3iamf_:

• d3iamf_ first appeared in SCOPe 2.04
  
• d3iamf_ appears in SCOPe 2.06
  
• d3iamf_ appears in the current release, SCOPe 2.08