Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) |
Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
Protein automated matches [191164] (14 species) not a true protein |
Species Thermus thermophilus HB8 [TaxId:300852] [255888] (3 PDB entries) |
Domain d3iamc1: 3iam C:1-95 [246794] Other proteins in same PDB: d3iam11, d3iam12, d3iam13, d3iam2_, d3iam32, d3iam33, d3iam34, d3iam4_, d3iam5_, d3iam6_, d3iam7_, d3iam9_, d3iama1, d3iama2, d3iama3, d3iamb_, d3iamc2, d3iamc3, d3iamc4, d3iamd_, d3iame_, d3iamf_, d3iamg_, d3iamh_ automated match to d2fug33 complexed with ca, fes, fmn, mg, nai, sf4 |
PDB Entry: 3iam (more details), 3.1 Å
SCOPe Domain Sequences for d3iamc1:
Sequence, based on SEQRES records: (download)
>d3iamc1 d.15.4.0 (C:1-95) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpkkgpd gkpllnekgepeiqwqpklaascvtavadgmvvdt
>d3iamc1 d.15.4.0 (C:1-95) automated matches {Thermus thermophilus HB8 [TaxId: 300852]} mvrvkvndrivevppgtsvmdavfhagydvplfcsekhlspigacrmclvriglpiqwqp klaascvtavadgmvvdt
Timeline for d3iamc1: