Lineage for d3i9vb_ (3i9v B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878903Family c.47.1.21: NQO2-like [142405] (2 proteins)
    complex I 24 kDa subunit; contains 2Fe-2S cluster in the active site; includes extra N-terminal four-helical bundle
    automatically mapped to Pfam PF01257
  6. 2878910Protein automated matches [254686] (2 species)
    not a true protein
  7. 2878911Species Thermus thermophilus HB8 [TaxId:300852] [255884] (3 PDB entries)
  8. 2878915Domain d3i9vb_: 3i9v B: [246767]
    Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v4_, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9vd_, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_
    automated match to d2fug21
    complexed with ca, fes, fmn, mn, sf4

Details for d3i9vb_

PDB Entry: 3i9v (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU
PDB Compounds: (B:) NADH-quinone oxidoreductase subunit 2

SCOPe Domain Sequences for d3i9vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i9vb_ c.47.1.21 (B:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
ffddkqdfleetfakyppegrraaimpllrrvqqeegwirperieeiarlvgttptevmg
vasfysyyqfvptgkyhlqvcatlscklagaeelwdyltetlgigpgevtpdglfsvqkv
eclgschtapviqvndepyvecvtrarleallaglragkrleeielpgkcghhvheve

SCOPe Domain Coordinates for d3i9vb_:

Click to download the PDB-style file with coordinates for d3i9vb_.
(The format of our PDB-style files is described here.)

Timeline for d3i9vb_: