Lineage for d3i9v4_ (3i9v 4:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2573281Fold e.18: HydB/Nqo4-like [56761] (1 superfamily)
    3 domains: (1) all-alpha; (2&3) alpha+beta
  4. 2573282Superfamily e.18.1: HydB/Nqo4-like [56762] (3 families) (S)
  5. 2573409Family e.18.1.2: Nqo4-like [144028] (2 proteins)
    Pfam PF00346; Respiratory-chain NADH dehydrogenase, 49 Kd subunit
  6. 2573416Protein automated matches [254688] (1 species)
    not a true protein
  7. 2573417Species Thermus thermophilus HB8 [TaxId:300852] [255886] (3 PDB entries)
  8. 2573420Domain d3i9v4_: 3i9v 4: [246759]
    Other proteins in same PDB: d3i9v11, d3i9v12, d3i9v13, d3i9v2_, d3i9v31, d3i9v32, d3i9v33, d3i9v34, d3i9v5_, d3i9v6_, d3i9v7_, d3i9v9_, d3i9va1, d3i9va2, d3i9va3, d3i9vb_, d3i9vc1, d3i9vc2, d3i9vc3, d3i9vc4, d3i9ve_, d3i9vf_, d3i9vg_, d3i9vh_
    automated match to d2fug41
    complexed with ca, fes, fmn, mn, sf4

Details for d3i9v4_

PDB Entry: 3i9v (more details), 3.1 Å

PDB Description: Crystal structure of the hydrophilic domain of respiratory complex I from Thermus thermophilus, oxidized, 2 mol/ASU
PDB Compounds: (4:) NADH-quinone oxidoreductase subunit 4

SCOPe Domain Sequences for d3i9v4_:

Sequence, based on SEQRES records: (download)

>d3i9v4_ e.18.1.2 (4:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mtlnvgpqhpsthgvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprm
dylhsfahdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltp
ffyafreretildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideye
alfaespifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvp
lgergdvfdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeavi
yhfkhytegfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyac
kgeqvpdmvaiiasldpvmgdvdr

Sequence, based on observed residues (ATOM records): (download)

>d3i9v4_ e.18.1.2 (4:) automated matches {Thermus thermophilus HB8 [TaxId: 300852]}
mtlnvggvlrlmvtlsgeevlevvphigylhtgfektmehrtylqnitytprmdylhsfa
hdlayalavekllgavvppraetirvilnelsrlashlvflgtglldlgaltpffyafre
retildlfewvtgqrfhhnyiriggvkedlpeefvpelkkllevlphrideyealfaesp
ifyerargvgvippevaidlgltggslrasgvnydvrkaypysgyetytfdvplgergdv
fdrmlvriremresvkiikqalerlepgpvrdpnpqitppprhlletsmeaviyhfkhyt
egfhppkgevyvptesargelgyyivsdggsmpyrvkvrapsfvnlqslpyackgeqvpd
mvaiiasldpvmgdvdr

SCOPe Domain Coordinates for d3i9v4_:

Click to download the PDB-style file with coordinates for d3i9v4_.
(The format of our PDB-style files is described here.)

Timeline for d3i9v4_: