Class a: All alpha proteins [46456] (290 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) contains a small beta-sheet (wing) |
Family a.4.5.0: automated matches [191329] (1 protein) not a true family |
Protein automated matches [190154] (92 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [187939] (6 PDB entries) |
Domain d3i59b2: 3i59 B:145-215 [246717] Other proteins in same PDB: d3i59a1, d3i59a3, d3i59b1, d3i59b3 automated match to d3i54b2 protein/DNA complex; complexed with cl, n6r, n6s |
PDB Entry: 3i59 (more details), 2.29 Å
SCOPe Domain Sequences for d3i59b2:
Sequence, based on SEQRES records: (download)
>d3i59b2 a.4.5.0 (B:145-215) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi rlegksvlisd
>d3i59b2 a.4.5.0 (B:145-215) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} dvpgrvakqllqlaqrfgtlrvthdltqeeiaqlvgasretvnkaladfahrgwirlegk svlisd
Timeline for d3i59b2: