SCOPe 2.08: Domain d3i59b2: 3i59 B:145-215

Lineage for d3i59b2 (3i59 B:145-215)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (92 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [187939] (6 PDB entries)

8. Domain d3i59b2: 3i59 B:145-215 [246717]
   Other proteins in same PDB: d3i59a1, d3i59a3, d3i59b1, d3i59b3
   automated match to d3i54b2
   protein/DNA complex; complexed with cl, n6r, n6s

Details for d3i59b2

PDB Entry: 3i59, 2.29 Å

PDB Description: crystal structure of mtbcrp in complex with n6-camp

PDB Compounds: (B:) transcriptional regulator, Crp/Fnr family

SCOPe Domain Sequences for d3i59b2:

Sequence, based on SEQRES records:

>d3i59b2 a.4.5.0 (B:145-215) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dvpgrvakqllqlaqrfgtqeggalrvthdltqeeiaqlvgasretvnkaladfahrgwi
rlegksvlisd

Sequence, based on observed residues (ATOM records):

>d3i59b2 a.4.5.0 (B:145-215) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dvpgrvakqllqlaqrfgtlrvthdltqeeiaqlvgasretvnkaladfahrgwirlegk
svlisd

Timeline for d3i59b2:

• d3i59b2 first appeared in SCOPe 2.04
  
• d3i59b2 appears in SCOPe 2.07