Lineage for d3i59b1 (3i59 B:1-141)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2816658Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) (S)
  5. 2816902Family b.82.3.0: automated matches [227198] (1 protein)
    not a true family
  6. 2816903Protein automated matches [226927] (20 species)
    not a true protein
  7. 2816969Species Mycobacterium tuberculosis [TaxId:1773] [231918] (4 PDB entries)
  8. 2816985Domain d3i59b1: 3i59 B:1-141 [246716]
    Other proteins in same PDB: d3i59a2, d3i59a3, d3i59b2, d3i59b3
    automated match to d3i54b1
    protein/DNA complex; complexed with cl, n6r, n6s

Details for d3i59b1

PDB Entry: 3i59 (more details), 2.29 Å

PDB Description: crystal structure of mtbcrp in complex with n6-camp
PDB Compounds: (B:) transcriptional regulator, Crp/Fnr family

SCOPe Domain Sequences for d3i59b1:

Sequence, based on SEQRES records: (download)

>d3i59b1 b.82.3.0 (B:1-141) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr
apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis
eqllrvlarrlrrtnnnladl

Sequence, based on observed residues (ATOM records): (download)

>d3i59b1 b.82.3.0 (B:1-141) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
mdeilaragifqgvetkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrrapdgren
lltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeiseqllrvl
arrlrrtnnnladl

SCOPe Domain Coordinates for d3i59b1:

Click to download the PDB-style file with coordinates for d3i59b1.
(The format of our PDB-style files is described here.)

Timeline for d3i59b1: