Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
Protein automated matches [226927] (20 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:1773] [231918] (4 PDB entries) |
Domain d3i59b1: 3i59 B:1-141 [246716] Other proteins in same PDB: d3i59a2, d3i59a3, d3i59b2, d3i59b3 automated match to d3i54b1 protein/DNA complex; complexed with cl, n6r, n6s |
PDB Entry: 3i59 (more details), 2.29 Å
SCOPe Domain Sequences for d3i59b1:
Sequence, based on SEQRES records: (download)
>d3i59b1 b.82.3.0 (B:1-141) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mdeilaragifqgvepsaiaaltkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrr apdgrenlltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeis eqllrvlarrlrrtnnnladl
>d3i59b1 b.82.3.0 (B:1-141) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} mdeilaragifqgvetkqlqpvdfprghtvfaegepgdrlyiiisgkvkigrrapdgren lltimgpsdmfgelsifdpgprtssattitevravsmdrdalrswiadrpeiseqllrvl arrlrrtnnnladl
Timeline for d3i59b1: