SCOPe 2.05: Domain d3i3eb5: 3i3e B:731-1022

Lineage for d3i3eb5 (3i3e B:731-1022)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.1: beta-Galactosidase, domain 5 [49995] (1 protein)
   automatically mapped to Pfam PF02929

6. Protein beta-Galactosidase, domain 5 [49996] (2 species)

7. Species Escherichia coli [TaxId:562] [49997] (42 PDB entries)
   Uniprot P00722

8. Domain d3i3eb5: 3i3e B:731-1022 [246698]
   Other proteins in same PDB: d3i3ea1, d3i3ea2, d3i3ea3, d3i3ea4, d3i3eb1, d3i3eb2, d3i3eb3, d3i3eb4, d3i3ec1, d3i3ec2, d3i3ec3, d3i3ec4, d3i3ed1, d3i3ed2, d3i3ed3, d3i3ed4
   automated match to d1jz8a4
   complexed with dms, mg, na

Details for d3i3eb5

PDB Entry: 3i3e, 2.1 Å

PDB Description: e. coli (lacz) beta-galactosidase (m542a)

PDB Compounds: (B:) beta-galactosidase

SCOPe Domain Sequences for d3i3eb5:

Sequence; same for both SEQRES and ATOM records:

>d3i3eb5 b.30.5.1 (B:731-1022) beta-Galactosidase, domain 5 {Escherichia coli [TaxId: 562]}
paashaiphlttsemdfcielgnkrwqfnrqsgflsqmwigdkkqlltplrdqftrapld
ndigvseatridpnawverwkaaghyqaeaallqctadtladavlittahawqhqgktlf
isrktyridgsgqmaitvdvevasdtphpariglncqlaqvaervnwlglgpqenypdrl
taacfdrwdlplsdmytpyvfpsenglrcgtrelnygphqwrgdfqfnisrysqqqlmet
shrhllhaeegtwlnidgfhmgiggddswspsvsaefqlsagryhyqlvwcq

Timeline for d3i3eb5:

• d3i3eb5 first appeared in SCOPe 2.04
  
• d3i3eb5 appears in SCOPe 2.06
  
• d3i3eb5 appears in the current release, SCOPe 2.08