Lineage for d3i2ka1 (3i2k A:2-351)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2150568Fold c.69: alpha/beta-Hydrolases [53473] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 8 strands, order 12435678, strand 2 is antiparallel to the rest
  4. 2150569Superfamily c.69.1: alpha/beta-Hydrolases [53474] (42 families) (S)
    many members have left-handed crossover connection between strand 8 and additional strand 9
  5. 2152071Family c.69.1.21: PepX catalytic domain-like [69581] (4 proteins)
  6. 2152120Protein automated matches [232528] (2 species)
    not a true protein
  7. 2152121Species Rhodococcus sp. [TaxId:104109] [232529] (9 PDB entries)
  8. 2152122Domain d3i2ka1: 3i2k A:2-351 [246646]
    Other proteins in same PDB: d3i2ka2, d3i2ka3
    automated match to d3i2ja1
    complexed with cl, dbc, gol, so4

Details for d3i2ka1

PDB Entry: 3i2k (more details), 1.51 Å

PDB Description: cocaine esterase, wild type, bound to a dtt adduct
PDB Compounds: (A:) cocaine esterase

SCOPe Domain Sequences for d3i2ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i2ka1 c.69.1.21 (A:2-351) automated matches {Rhodococcus sp. [TaxId: 104109]}
vdgnysvasnvmvpmrdgvrlavdlyrpdadgpvpvllvrnpydkfdvfawstqstnwle
fvrdgyavviqdtrglfasegefvphvddeadaedtlswileqawcdgnvgmfgvsylgv
tqwqaavsgvgglkaiapsmasadlyrapwygpggalsveallgwsaligtglitsrsda
rpedaadfvqlaailndvagaasvtplaeqpllgrlipwvidqvvdhpdndeswqsislf
erlgglatpalitagwydgfvgeslrtfvavkdnadarlvvgpwshsnltgrnadrkfgi
aatypiqeattmhkaffdrhlrgetdalagvpkvrlfvmgidewrdetdw

SCOPe Domain Coordinates for d3i2ka1:

Click to download the PDB-style file with coordinates for d3i2ka1.
(The format of our PDB-style files is described here.)

Timeline for d3i2ka1: